DPCstruct | MC58686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 287 ± 69 aa |
| Standard deviation of domain lengths | 68.74 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.94 |
| Pfam Score | 75.74 |
| Assigned Pfam label(s) | CL0611- PF21738- CL0126- CL0055 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7X9Z9 | 2-327 | RKEKLVNFQNIAPGQTAILTCPLGPTYERIKINLTGGLLISMITNIVGKINDKPFFTVTGNDLLAENLYEGRSNPTNLLLLDFTRMN… |
| A0A8B6C3V0 | 12-298 | RKIREPRGVKGIRQSVSITNNPSTIDQNQQLLVRFPNLSNNDVIVPGTTRLAFEIELTSTDDNATIYQNIGRAIVKKTTIRISGNEI… |
| F4PZZ7 | 12-256 | None |
| A0A2B4S255 | 101-368 | None |
| A0A2B4SFD5 | 184-542 | None |
| A0A5N3ZZW7 | 10-330 | None |
| A0A813AZC0 | 2-339 | None |
| A0A6S7GTK2 | 8-227 | None |
| A0A2B4S5A7 | 91-268 | None |
| A0A6P8H8W3 | 23-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.