DPCstruct | MC58684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 258 |
|---|---|
| Mean domain length (aa) | 206 ± 34 aa |
| Standard deviation of domain lengths | 34.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 15.46 |
| Pfam Score | 66.81 |
| Assigned Pfam label(s) | CL0001- PF01684- CL0422- CL0117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q17KU3 | 74-253 | CTAGSCESCNSDYCNVLGATQHKCVVCSSVLDENCISNPGELPGQQCGAPSTDVAETQCYSRVIGSVTERGCIQSQSDLDTCDGIQC… |
| A0A8B6C375 | 20-210 | STIHCTRICYSCTNLQENEKCLHAVQCQNDEVCFTQKYQTSENVIRYDVGCTYPEICRKDLTGNLVGRRSDHSHMMCQKCCNGSHVC… |
| A0A2D0QHL7 | 23-220 | None |
| A0A3S1B7L1 | 21-215 | None |
| T1GQZ3 | 166-318 | None |
| A0A7R8X1N7 | 239-473 | None |
| A0A3B5QVT8 | 4-142 | None |
| A0A803JS12 | 98-291 | None |
| A0A7E4VLM7 | 217-404 | None |
| A0A6P8IDF1 | 2-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.