DPCstruct | MC58683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 45.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4B2W5 | 353-455 | EIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQ… |
| A0A8B6C0V1 | 15-116 | FYIEPSKGIGKACMDSLVQLPRILCQEEKEAFSKTTDGTDLDLITKLHNVSVYTKSLCHITEVMSGPLIQALENRLETNRSRIQTLQ… |
| A0A8B6EQD8 | 1-90 | None |
| H9JBC7 | 111-218 | None |
| A0A1S3CTK7 | 47-134 | None |
| G5B9D8 | 144-254 | None |
| A0A3Q7S1F9 | 246-347 | None |
| A0A340XRS1 | 26-138 | None |
| A0A7R9EHH6 | 658-776 | None |
| F6WPB7 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.