DPCstruct | MC58674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4XDT2 | 5-104 | AKILRLVLGDQLNPQHSWFADADADVVYVLMEVRQETDYVLHHAQKILAIFAAMRDFARGLRAAGHRVRYVAIDDESNRQSVTENLA… |
| A0A1Z4PV91 | 1-77 | MTIGVWILGDQLWIEQAALQSCQQKVPVIMIESLRHVQARPYHRQKLVLVWSAMRHFAEELRQLNYRVTYKLAEDFE |
| A0A2D6ENT5 | 1-95 | None |
| A0A354V0T5 | 2-73 | None |
| A0A2K4VWH5 | 21-97 | None |
| A0A259M5A0 | 201-299 | None |
| A0A388PHV9 | 1-94 | None |
| A0A433W3N3 | 245-335 | None |
| A0A6I3IWH8 | 1-88 | None |
| A0A423PJW6 | 4-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.