DPCstruct | MC5867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2DAI6 | 1-102 | CEVSTEDQTTFDQFVADITASPPQVVRTADDFDVQWASPSNGEMTFGWDAPFVVDGHEQDITDFPRHDSRWGRVERLQKQYRLSQGR… |
| A0A7K4CRP4 | 299-399 | ELGSVDENGSFQTFINQVTSAVVTIVPLSIGYDITYHSPSRGLVRVAWKGKMVVNGVQINTGDYLRYDNPYCTQLFGTTTTFIHLGA… |
| A0A7C6J732 | 153-240 | None |
| A0A7C4PMC2 | 114-202 | None |
| A0A7S2XK77 | 205-306 | None |
| A0A3E1EB53 | 246-345 | None |
| A0A1I4N5E3 | 87-174 | None |
| A0A3M1P0W6 | 132-224 | None |
| A0A7X7VA30 | 176-269 | None |
| A0A3B8MKB5 | 47-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.