DPCstruct | MC58669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 119 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7QTN2 | 1-121 | MLIENYAFMQSISFWPPLATMGVFATTLSAALGNLVGGSRILEALARDDIFGIVLRPMKWSTKNGNPILAVLFTHLLVQLVLFIGSL… |
| A0A060YQN3 | 124-246 | LVIGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLMQAISRDGVVPILRVFGHGKANGEPTWALLLTAGICEIGILIASLDAVAPI… |
| A0A819RKJ3 | 191-312 | None |
| A0A1S0TEN4 | 1-128 | None |
| A0A4Y2IKN8 | 2-108 | None |
| A0A3P7FS75 | 200-312 | None |
| A0A368F7U3 | 3-123 | None |
| A0A814XWL9 | 186-307 | None |
| A0A3P6TFS8 | 30-149 | None |
| A0A1B7NLS5 | 49-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.