DPCstruct | MC58664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 163 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 93.37 |
| Assigned Pfam label(s) | PF09779- PF10476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7P7Q9 | 26-169 | VVQICRWIKNRYVLVHCWFCNSPNRIHVSARNSFVCSACKQYNGFTPSGDYNKEIPEMYQTTGNPSAFVSQSKEAFVSHSNVLCAVC… |
| A0A0K0DG79 | 14-157 | PLVYRSLRYHFYTKVNCWFCQHDQRVPFEQQNSFICASCEQYNGFDESGGYNRKIPGQHCVVAVKPTRRFCTSNMKGSGSNGLCDNC… |
| A0A1Y1VBV5 | 37-221 | None |
| A0A162PHV2 | 38-204 | None |
| Q3TXY3 | 2-160 | None |
| A0A0G2FEP4 | 10-167 | None |
| A0A0F4YTQ7 | 3-159 | None |
| A0A0H2S931 | 8-195 | None |
| A0A5F8AAE2 | 166-333 | None |
| A0A482WFU8 | 13-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.