DPCstruct | MC58660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7P0M4 | 1-64 | MRDSKSDGLPLGFIRVGKKSLFLFDSFGECNEVEPTCVLDFYVAGPFRRKGYGRRLFEGMLRVS |
| A0A653DH68 | 88-157 | GAVTGMLKTGSKGLYVFDREGQHYQVSPPCVLDFYVHDTRQRTGLGKRLFEHMLQKEGIEPVKMAIDRPS |
| A0A833R921 | 28-107 | None |
| A0A6S7HEM5 | 534-603 | None |
| A0A3P6HLC6 | 1-59 | None |
| A0A6I9YGS5 | 85-150 | None |
| F0WEW6 | 71-124 | None |
| A0A183LQP8 | 93-147 | None |
| A0A1X7TI66 | 33-98 | None |
| V6T910 | 9-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.