DPCstruct | MC5866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4K2Q2 | 1-102 | MRKNRNNRPPEVGARGLLRLRCPCCGKEFGTYLHVSQMSIGCRCGATISLERGLAHYEFKCGCCGMHAKGQTNIEELEITIPCKCGN… |
| A0A6L5TFC3 | 1-86 | MMRLKCPKCGDVFVAFTKDYRTEWTCKACGERFSLENTALFEYDCSCGRHTYGRTNIEDADFSYPCGDCGKATTLKWNPKAKKYME |
| A0A1C6ILI7 | 244-345 | None |
| A0A2A7A593 | 129-230 | None |
| A0A4Z0Y7S9 | 46-151 | None |
| A0A1Y4VG08 | 116-205 | None |
| A0A7X5CYB2 | 195-297 | None |
| A0A2A6Z7S4 | 117-217 | None |
| A0A3D2I914 | 169-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.