DPCstruct | MC58658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 312 ± 46 aa |
| Standard deviation of domain lengths | 46.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0392- PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7E0A5 | 217-542 | FSRYKDVLAPYKYSGYPMLIKTIQLEADDEQLFSKETSLLAAAAELTYHTINCSALNAEELRREKGLEVLQGAYNRCVSVLNSSSKP… |
| A0A3P7NWN9 | 25-362 | LLHFLKKDLSLLPIPSDGRPATKRRVGHIDSALEALRNVVRSYPGTELQCVGHFDALFSILDMDGYDDLKLRALDVSLLNLSMFTLF… |
| A0A7R9ANQ3 | 2-284 | None |
| J9EBV4 | 1-295 | None |
| A0A1X7SMX1 | 24-327 | None |
| A0A7E4RVE3 | 146-533 | None |
| A0A6P8IXI7 | 12-283 | None |
| A0A2I0TJM6 | 380-664 | None |
| A0A368FDV3 | 4-247 | None |
| A0A7J9HKG6 | 138-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.