DPCstruct | MC58656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 126 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226EZU2 | 2-101 | ASTDLMHRIVALQQFDGSFNLDPTVCAAISVNHTVVSQRAQQRGWDSKAFAVTLVLAFLKEKLASLQDDWELIADKSRIWLMQNAAH… |
| A0A3P7NRH5 | 11-115 | EAPKDILVAIAELQNLNGFWKLEADLADLLDCPLDKLMSTKPKNLAELEDTVWATALVIAFFKTKVADRRLEWQLMSTKAQNWLATR… |
| A0A226EMT5 | 922-1044 | None |
| A0A5J4NBH2 | 48-202 | None |
| A0A421D4Z4 | 1109-1260 | None |
| A0A2D4H7S6 | 214-333 | None |
| A0A7S2V3A5 | 64-198 | None |
| A0A834RJP8 | 280-452 | None |
| A0A1I8FNJ3 | 913-1030 | None |
| A0A1S3NU73 | 147-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.