DPCstruct | MC5865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5RC76 | 7-122 | VIRGTVRTGYVSAGGYAYKVRRVLFAQLKHLVQAGKVDQKEVARAAGYLNTLLYHLVVEQMGFTKSDALRITVNYAVRNGTIEWDLD… |
| A0A7J2JGP2 | 2-115 | PHLSTGTVVAAGYANKVRRVLFAITKGLDPKEVARAAAELNQRVWQIIQEKQIDKDEVIRVSCDFDVQDGKIVWNYDTLKVQRYLPE… |
| A0A7J2LRB2 | 10-120 | None |
| D7D9F8 | 5-127 | None |
| A0A7J2VZD0 | 2-92 | None |
| A0A832G9D1 | 1-123 | None |
| A0A7L9FHD9 | 2-126 | None |
| A0A6B2BZH5 | 24-141 | None |
| D3S1F3 | 1-114 | None |
| A0A117SPB3 | 28-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.