DPCstruct | MC58647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444Z6X7 | 3-72 | ERVRTGIWVGDCFIYNYSSWRLNYCVSGEVTTMSHLDRPMYLLGYLASQSKVYLIDKEFKTLVMRGDLDR |
| A0A3P7IBU6 | 117-213 | QSEGVKTAFWIGDCFVFTTVLNRLNYYVGGEIVTIAHMDRPLYLLGYMAKESRVYAVDKELNVVSYRLLLCVLEYQTAVMRRDFETA… |
| A0A177U3T0 | 137-254 | None |
| A0A817NEA6 | 209-289 | None |
| A0A0R3S5B2 | 1-72 | None |
| A0A7S0JPX2 | 198-294 | None |
| A0A183WTA2 | 1-89 | None |
| A0A7J6U002 | 535-634 | None |
| A0A6A4KDS7 | 169-265 | None |
| A0A6A6LIS7 | 841-933 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.