DPCstruct | MC58645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 181 ± 39 aa |
| Standard deviation of domain lengths | 38.68 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7MBF0 | 17-168 | AYWDEFLRTPEVRRNRSCIRPEISRTITFGSTGVSGGQFYSSHLRFIQLNREHVPFLKLDLSYLFPQIYNPRFHRQVYQDAQPISIS… |
| A0A6B0RSZ4 | 6-134 | HEAYFKKHKFSMVPGVQLRNVDGLKKDAYEVEVHRLLSEAEVLDHSKNPCEDSFLPDTEGHTYMAFIRMEKDNDFTTWTQLAKCLRI… |
| A0A7J6KTR8 | 416-648 | None |
| A0A6A7G4M2 | 638-872 | None |
| A0A6A7FYK8 | 484-709 | None |
| A0A7R8X812 | 108-320 | None |
| A0A151GZ29 | 54-180 | None |
| A0A2G8LRD8 | 137-344 | None |
| A0A0C2MAU4 | 202-384 | None |
| C3ZWL5 | 31-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.