DPCstruct | MC58642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8JTM5 | 3-123 | KDKKAKAAEKKARTAAKSSKKAAKKEKKVTNKRRPGDDSDSDDQDIDAILEEYKLKQAQHMAIAETICPPPPVRANSILMPHPTNSK… |
| A0A6I9P877 | 3-108 | KKSKKEKKVKGAEKTAAKMEKKVSKRSKREEEDLEAMIAEFQNLDAKKTTVVETICPPPSARLSASISAHPEKDELILFGGEFFNGR… |
| B4HG38 | 1-125 | None |
| G4TKS7 | 5-146 | None |
| A0A5E4QSF0 | 1-117 | None |
| A0A517L6X5 | 453-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.