DPCstruct | MC5864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832TGT1 | 1-74 | MKLEDIERIHEAALRELYRRIPKRDLEDVDVTVTVDGKSVDVDVKVEVHPLSELSDEEIKEAVERAAEAAIKEA |
| A0A7J2JG21 | 1-89 | MPSLKEICEAAEEAVRSYILSKVRLSDVTRLDIEVKLLDSERLLFEISVDLEVNPLLDIDAEKLAEEAIDKGFEVIGKAAGGGRPHE… |
| A0A7C4HFJ7 | 1-77 | None |
| A0A0F8CJN9 | 2-87 | None |
| A0A7C0UTR1 | 15-90 | None |
| A0A347AKR2 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.