DPCstruct | MC58637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 217 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LY45 | 1-183 | MARTHVAPKAMSHKSKNSVKTVTISNRVLPVSPVLDTLFSFIAERHAIHQRRIAGEAFPWTDDPVLLKYSFTNVFRVLDRMTQTSTY… |
| A0A3R7EFK8 | 6-179 | DFFEFIYRRQVVWYRRFFLKEKPPWTKDDVLQKYKFCNVYRELDKGTAYIIDTLRHIRNRKKILLNVVFYRFFNKHLLYEALNIKPF… |
| A0A5N5QSI0 | 121-345 | None |
| E2LTS6 | 61-299 | None |
| A0A4Y9YW51 | 6-225 | None |
| B7G6Z2 | 1-273 | None |
| A0A317HQV3 | 50-252 | None |
| A0A5M6BSZ1 | 36-260 | None |
| A0A363SHD0 | 211-419 | None |
| A0A316UK11 | 50-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.