DPCstruct | MC58631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0125- CL0094- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4RTT1 | 26-135 | QEWTFPEQAQLAAIRFRFKSQSAPVQYATSLATSLRKPCPRESILSSSYLTNKFDPKLIQDTMNLLKPEHCRIVIGSQSGEFENRIK… |
| A0A822AUC0 | 2-136 | IVYQYLAMLRKEGPKEWIFNECKNLNEMHFQFREKERPAKFVSNLALRIRNYPLTECLSGDYEMRELCPDLINDVLNEYVIPSKMRV… |
| A0A6P5V9T4 | 21-144 | None |
| A0A7S1YUI2 | 17-192 | None |
| A0A819YRN0 | 1-119 | None |
| M7PED6 | 1-123 | None |
| A0A3M7B193 | 18-142 | None |
| A0A4U9IJF5 | 81-193 | None |
| A0A7R9PNE1 | 126-260 | None |
| A0A072P5K9 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.