DPCstruct | MC5863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 3.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840AZM0 | 1-52 | MANSFRMLTAGDHVVCAETGQAIPLEELRYWSVVKQEPYVSADASVRATMKK |
| W9DYC8 | 4-61 | KLAKIKYLPNNFKVIQDGDHVICAISGKKIPLENLTYWNVEDQEAYFSYIEAEKKREK |
| V4N7W6 | 28-88 | None |
| A0A3B0S201 | 37-96 | None |
| Q1MKU8 | 57-119 | None |
| A0A059DQ27 | 32-95 | None |
| A0A6I4T408 | 3-63 | None |
| A0A2E5KRG9 | 7-65 | None |
| U4V1E3 | 24-90 | None |
| A0A836TQ88 | 4-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.