DPCstruct | MC58627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 511 ± 74 aa |
| Standard deviation of domain lengths | 74.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J6I3G5 | 1-481 | MAAAAAASGAKLNLTEAFNFEVLNTGMISATAKCNHAGGIAGIRRLYDSIGSLDLPALGPSDMVGNLQPKTESFSDVLLTNFVQHLQ… |
| A0A6P3IXY2 | 9-424 | TVLKTMLDILQTLSLSLSALNKMMVQELKAALGAGDAQQYTQAMFKLTAMLISSRDCDPQLLHHLCWGPLQMFNEHGMETALACWEW… |
| A0A820BUY9 | 4-532 | None |
| A0A7E4RGV4 | 1-484 | None |
| D2W2E0 | 37-557 | None |
| A0A4W6BHU6 | 583-1078 | None |
| A0A7R9HL73 | 1-467 | None |
| A0A3P7EVW6 | 843-1484 | None |
| A0A6A4V1X6 | 264-862 | None |
| A0A6V7PP44 | 169-716 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.