DPCstruct | MC58626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180G6H9 | 148-250 | KNSADDFKEGTTQSDDDRMDALAITPVCLRIAFSIDNLLGYIPLRVNDPNCLAEKEREESEGFDPCCCSNCDGPAAVQLMENLPFAS… |
| F4RCU0 | 161-264 | NMPNSPNTASEVVVTDTMNNEERMHAFRLTPCCLRAAYNMDMDILYRYIPMSLTDPGYLAEMERQRTAGMAVCRCSNCDPQGAARVL… |
| A0A2S4VW55 | 1-112 | None |
| A0A2N5VTT4 | 533-642 | None |
| A0A180GA60 | 263-362 | None |
| A0A5B0PVH1 | 80-191 | None |
| A0A5B0Q737 | 62-161 | None |
| A0A5B0QMV7 | 19-107 | None |
| F4R643 | 24-149 | None |
| F4RMV9 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.