DPCstruct | MC58623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 160 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4SA65 | 86-242 | KRLEEAEAALRNLLDADPAVGGDYFENKWNDQKTRQLDVINETTKEKRERLLILIGLAEELVVAHDRLKAIQNKRRRVRTQADNNNL… |
| F4RFC7 | 39-201 | THARERSLKATKTLNDLLQSDPRYTQDYFAAQWARQRALQLAAMADESRLKFEERLVHLLDLEEKLQESHVKLASLRNTRDPNTTES… |
| F4S8J4 | 2-158 | None |
| F4SAT7 | 28-190 | None |
| F4S2X5 | 1-155 | None |
| E3K763 | 5-132 | None |
| F4RFZ3 | 46-210 | None |
| F4R9N8 | 93-269 | None |
| F4RS97 | 135-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.