DPCstruct | MC58621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 394 ± 43 aa |
| Standard deviation of domain lengths | 43.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4RQU4 | 61-468 | RQEYTNMAREHSRLHRARLEREKGKNMLHERFKASEILGPLNEELEYKAHSSSVFSELVQRFVDLFTDAEKMRKLLALCKSAKTQSE… |
| F4R304 | 53-472 | YFMEQKRDLAESSSTTYTLHSRKHFELLDTSNIPLEYRASPPIPRPSARNLEPYKDLVSAALESSLPGTLPRLFKSASRPNIFDSPD… |
| F4RQU2 | 2-366 | None |
| F4S821 | 102-508 | None |
| F4S3G6 | 19-391 | None |
| F4RVQ7 | 29-418 | None |
| F4RQY3 | 3-441 | None |
| F4RM51 | 10-294 | None |
| F4R9B4 | 41-439 | None |
| F4RGV5 | 52-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.