DPCstruct | MC5862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 130 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T6LZN7 | 90-219 | SSDDEEDDYERLLRSAAGVAVAEIVCHRDTWAFLVERTATNEHFRLPADIDERPDGTVTVRISGRSLTAAVEALREARRAAPSPAPT… |
| A0A7L5SM08 | 12-140 | DPEAEAKPDEHRQHLRGLLKAAAIACARLVCHRDTWTFVIEQTSQHPHFRHPDQVSDLNDGQIETILSGRSLLAILVTMRKVLDDCV… |
| A0A3M0I712 | 52-185 | None |
| A0A7K1WAP3 | 185-308 | None |
| A0A3Q9KDV0 | 64-209 | None |
| A0A150VLC7 | 2-117 | None |
| A0A3R7EW77 | 70-208 | None |
| A0A291T1S0 | 80-228 | None |
| B4VAY2 | 349-474 | None |
| A0A7K3EFZ3 | 31-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.