DPCstruct | MC58617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 208 ± 41 aa |
| Standard deviation of domain lengths | 41.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18788 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6M1A2 | 103-320 | APPNWRVHESAGGGYRIDLPAGPLSGMDKQLGMPPLQGGAVEGTVHRRTQYIVFWGDIQNRAWRTDDRILEDTYQGAVAGGKATRVV… |
| W1J380 | 3-263 | EIVSLEEIEQGYLGHAGVSDETAMFESITTTRIRLSNTLRAFIRKLNQGLSGTGILAGPTDNGLPSVGGAEIGRVRKVGVIPVMAAK… |
| A0A5Q0BHF7 | 437-608 | None |
| A0A1Z4BV75 | 21-247 | None |
| A0A756W3B1 | 4-293 | None |
| A0A2K4IBK9 | 6-156 | None |
| A0A4R6Y2F8 | 2-206 | None |
| A0A507WBT9 | 218-509 | None |
| A0A1L7NPT4 | 251-434 | None |
| A0A2T5IRS3 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.