DPCstruct | MC5861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T6LX15 | 24-212 | DVGAALRRLAVDAARARRNTASTPGSRAKVMLVVVSRWVLDEPLAGPRLARLADEEPLEAEGALVFACLLHLASHPESAQFWWQLAA… |
| E4NIZ5 | 30-208 | LTAPRPFPSENLQAAHELDLAASLVLAMPTAAASLDLLVNDRRIHPEGALVLGALLHTARHRDAAQFWWQFAAGGGSYTAASCLSLL… |
| A0A542QIE4 | 74-203 | None |
| A0A1I1QCL9 | 58-206 | None |
| A0A6B2S1S9 | 7-164 | None |
| A0A4D4N8F1 | 331-464 | None |
| F3Z7B7 | 681-869 | None |
| A0A6B1MFJ1 | 22-213 | None |
| A0A7W9UW48 | 4-213 | None |
| A0A6I5BR66 | 3-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.