DPCstruct | MC58609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 274 ± 47 aa |
| Standard deviation of domain lengths | 47.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 87.40 |
| Assigned Pfam label(s) | CL0229- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670YUB7 | 2-224 | RHIEDICICCGGFEIHTQHPLFHGGMCAPCSERLLERFFLCDDDGYQADCTICCWGKSLIMCDHSACHKCFCEECVDTLVYPGHAEE… |
| A0A6G0IN25 | 35-335 | REETICRIMEMKLDIEGFCLCCGTEDVEIFHPLFKGSLCLECKDNLTQTLYLYDEEGYQSYCTICCYGLEIILCGYDSCCRSYCADC… |
| A0A6I9XTX2 | 1-296 | None |
| A0A1I8FN39 | 1-261 | None |
| A0A401RZ46 | 2-276 | None |
| A0A7E5X444 | 35-290 | None |
| A0A1I8IHU3 | 61-284 | None |
| A0A1I8IPI0 | 79-424 | None |
| A0A182FVT4 | 41-256 | None |
| A0A6I8T2T0 | 214-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.