DPCstruct | MC58601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0475- PF01627- CL0320- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5P4V5 | 7-132 | RQQLSTMRQSFFDEGLLDHGQVSYLETLENEDDPDFIENLFTLFLRDSSKYIASIEKALETTLDDFPFILERMMYRLKGSSASIGAT… |
| A0A2P6QHV5 | 7-133 | NQKLNELISSLQDQGILDDYFDELKGLQDEQSPQFVTNTITIYLGGADDTIAELTKNLSEPAVNYPRVTYLADKLKGSSMSIGGARM… |
| A0A7X6CM44 | 33-160 | None |
| A0A7X6HRQ5 | 274-407 | None |
| A0A522N1P3 | 43-157 | None |
| A0A2N2GAE8 | 1070-1198 | None |
| A0A2W1AAQ4 | 78-212 | None |
| A0A835HAM7 | 7-146 | None |
| A0A1P8WMF9 | 1120-1252 | None |
| A0A127ZDJ3 | 10-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.