DPCstruct | MC5860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 318 ± 42 aa |
| Standard deviation of domain lengths | 41.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536DWS9 | 68-387 | AGPRRANYRSYSLLVRRIDGLRKRRDLICRHARNDAALVCEQVGKSLDDLCTQLRTPGVTWVLGTGYIAAWEAVHRAEEMLIEAEEK… |
| A0A0T6LWP2 | 15-298 | AATRVMLLVKEHHRLGSELALLGERAGERGAQIRASLDVAWDHLTHRRPDPLVGAAYLALADQSLVWLLPRPRLVSRGTVVLATLDA… |
| A0A843KI49 | 45-362 | None |
| A0A6J4R106 | 144-475 | None |
| A0A6N7KL05 | 3-244 | None |
| A0A849S416 | 112-433 | None |
| A0A1H6NVL4 | 182-461 | None |
| A0A221Q6P2 | 4-388 | None |
| A0A535VH69 | 17-333 | None |
| W6K172 | 6-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.