DPCstruct | MC586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7NQX9 | 6-84 | LDTLAPSGETVFDYDRRHLLTYAELLDAEKDGIPWQDGALEILGIDPVTDASRAQACWDSHLARARWITGAGLRIAIAA |
| A0A440L421 | 8-84 | PHFADVAPTSSVLTAYDEHCMLTYIRLLDASADGADWREVAYTVLQIDPNQEPERAFRAWATHLARARWMTGNEGWR |
| A0A2G2D469 | 18-88 | None |
| A0A3N2QEB8 | 1-75 | None |
| A0A4T3FLR1 | 1-80 | None |
| A0A369TTS2 | 3-84 | None |
| A0A562MQX2 | 86-158 | None |
| A0A562MLI9 | 75-155 | None |
| A0A1M5P553 | 3-76 | None |
| A0A530BVL7 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.