DPCstruct | MC58592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 239 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358PVE2 | 135-371 | MNGIPAIGINIHTLGTETYDDVVTDILTGNRFELDVLDYIPEIKGNPQAMEVIAELMAKLPDMKIEGDMSEDLEAKLWEKRMPDLTP… |
| A0A0M6WSZ6 | 1-230 | MHGIPSIGVNMHIDGTEEWEDEEADIVRENCIDVDFLNYTPELRDTPIVQDALKKLIAAYPDKEVNDRETKKAKIQTIATELDQLSY… |
| A0A7U9MV89 | 266-537 | None |
| A0A3A8YAM1 | 189-438 | None |
| R9L337 | 45-278 | None |
| A0A0V8QC47 | 1010-1248 | None |
| A0A373CS29 | 228-451 | None |
| A0A7U9SQV3 | 3-202 | None |
| A0A0V8QCG1 | 599-863 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.