DPCstruct | MC5859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 130 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 22.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368VVE5 | 11-139 | LAHTAGKLGLRDAAEGYAQAVHEAAEAVGVALAGVDVAGDGTRISVRPATQPELTVEWVPAAGWYLNTEDGSRAYRVTREADAAGVI… |
| A0A0T6LN77 | 136-272 | SAASVPYHDAHTPYIRAVAKALAALGVAVHDWDTMPDDPRTAHITLDTGPATAAYGDADVGLLWSEESGWAIAWDTRESGRYEALAD… |
| A0A6N7L5B5 | 11-168 | None |
| A0A0X3UZD9 | 3-130 | None |
| A0A2T0KDA0 | 56-180 | None |
| A0A853BPZ5 | 3-107 | None |
| F3ZN82 | 1-141 | None |
| A0A075V1V8 | 1-137 | None |
| A0A1C4IVN9 | 1-151 | None |
| A0A1Y2NGR1 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.