DPCstruct | MC58573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 212 ± 40 aa |
| Standard deviation of domain lengths | 39.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3PHQ2 | 11-204 | QGLLKTNEHSPPSFTVRLYREYWTLNNGSKFLYNSQTASLLDDIRAQHIPVDFIELFDAAGLPFFEGCLIVELLDYRPARSNEPELD… |
| A0A7J8GNG1 | 61-235 | NLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDY… |
| A0A2H9TPN6 | 452-658 | None |
| A0A803LDI4 | 35-226 | None |
| A0A182JTP4 | 253-550 | None |
| A0A1S3G0U4 | 108-319 | None |
| A0A177WRM9 | 7-265 | None |
| A0A4W2GJN7 | 47-307 | None |
| A0A821DBL6 | 33-268 | None |
| A2DRL4 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.