DPCstruct | MC58572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 290 ± 59 aa |
| Standard deviation of domain lengths | 59.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3PG80 | 4-305 | ACDVYTKLLFRRGHGYPLWEPEPTKAGEVLVGDVGYILEGSFYRLFNATLPAGHAVHQQCGVPDGYEPFIYPDTLLHRRAHALQPGP… |
| A0A7W4I5W8 | 9-242 | VLTNIIRRTNLYAWGNWSLNPGVQPGAVGTIDPDTGIFSQVTTLSDLKITDLPASENWAVNDSSVRRQQTDVDFAGGYQDPTTSMKV… |
| A0A2H3C112 | 19-216 | None |
| A0A146HEP4 | 105-321 | None |
| A0A0C9TQ24 | 6-330 | None |
| A0A0C9TQR4 | 3-222 | None |
| A0A0C9TWJ5 | 3-229 | None |
| A0A165Y9K4 | 1-335 | None |
| A0A0C2Y0Q8 | 79-293 | None |
| A0A0C3BCY9 | 41-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.