DPCstruct | MC58570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 254 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 70.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L659 | 2-261 | KVQLEATAKSEQLGEVHGAWLPPWLAAHAAHYMELMSSHWSEHGKPAVNNLLQKASEKTVQAKEWAEPHIETAKAKWIPVIKENWAT… |
| A0A068VGH5 | 2-258 | MKAKFEATSRSIALIEVHGAWLPPWLAVHLTRYQTLLEKHWEEHGKPAADALLQKAIKGKAKAEIWAGPHIETIHTKWIPVIKEQWL… |
| A0A6P5GMT1 | 247-507 | None |
| A0A833RSD6 | 68-329 | None |
| A0A2P5WRL1 | 186-451 | None |
| A0A7J0GCV0 | 13-268 | None |
| A0A1D6ESJ0 | 198-449 | None |
| A0A2P2L2P5 | 127-380 | None |
| A0A540LK26 | 429-674 | None |
| A0A4D9B871 | 946-1166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.