DPCstruct | MC58567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 441 |
|---|---|
| Mean domain length (aa) | 242 ± 41 aa |
| Standard deviation of domain lengths | 41.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 73.55 |
| Assigned Pfam label(s) | CL0023- PF08488- CL0264- CL0087- PF13947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068VB63 | 76-360 | LSISRVSSMACLLMFILLVLFQAIIPVVLSHGNAQTCRSYCGNLTVDYPFATQSGCGHPGFRDLLFCINDVLMFHISSGSYRVLDID… |
| A0A835DTX2 | 1-182 | MCGNIHIPYPLGIGDGCWKNKNFTITCNYSYNPARAFSHGGFEVIDISLETGEMRVFTGVAHICFNSSNTTSSMNSGWYNFTRSPLL… |
| A0A022QVL5 | 21-288 | None |
| A0A7N2L9W3 | 7-239 | None |
| A0A7N2LAC2 | 8-236 | None |
| A0A7N2LAT5 | 130-358 | None |
| A0A022QWG4 | 9-177 | None |
| A0A1R3JCH7 | 595-928 | None |
| A0A0Q3QEK1 | 3-207 | None |
| A0A368QKK5 | 4-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.