DPCstruct | MC5856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2B3N3 | 1-63 | FKVGDKAKVRKSATNYQTGQKIASFVKGQTYKVKQVKNVNQSRSKKAYLLDGINSWVLEQDLE |
| A0A7I0GN89 | 1-82 | MTSAPTETPDIDKGQQADDSSKKDIKAGDTVKVNFSASKWATGEDILPSVKGQSYKVLETSGDHLLLDGVYSWINRKNVEII |
| A0A3A6DNS6 | 140-216 | None |
| A0A1Q6KLK2 | 191-265 | None |
| W7BU60 | 54-138 | None |
| A0A3D0Z3L1 | 195-253 | None |
| A0A417IH62 | 72-131 | None |
| A0A3B8UN61 | 296-376 | None |
| A0A354MXA0 | 24-83 | None |
| A0A0R2DWK2 | 164-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.