DPCstruct | MC58555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 77.94 |
| Assigned Pfam label(s) | PF16191- CL0105- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8EFG3 | 322-410 | GLMCIALGKTITGATQANPVALTVAAHGYTTGNVVQIDSVEGMTQLNGKLYTITVTDANTITLNAVDGTAFTAYTSGGITTKGVFYA… |
| A0A661R439 | 395-479 | GVTCIAADKTITAATNANPCQVTAVGHGRSTGDYAMVRSVGGMTEINDKIFTITVVDADNFTLDGVDSTAFAAYSSGGSITVGDF |
| A0A834T8L7 | 241-338 | None |
| A0A1G0RDV6 | 3-93 | None |
| A0A2V6GV06 | 251-357 | None |
| A0A222EBL2 | 783-887 | None |
| A0A317HPX7 | 71-161 | None |
| A0A672GT43 | 166-260 | None |
| D5SZF6 | 31-122 | None |
| A0A3N5F2L2 | 148-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.