DPCstruct | MC58551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6CQB6 | 93-181 | ELKGWCRGEALDEAHAVMVLIQEDVDPSAIEETMQTVKCLGRVRVRGRIYNSQLNRYLVLCECKEVVKGEIVPFEVLPIAGGGPWPV… |
| A0A672HP40 | 4-80 | LKRLCRGEDLEDAKALMVTVPEEAGIAKIEETVSTVKCFGRVHVRSRMFNLSLNHLMVLCECWETFSHEDVPTEVVH |
| A0A3B4G7D9 | 3-82 | None |
| A0A3B5QYJ0 | 6-84 | None |
| A0A485NLB5 | 2-79 | None |
| H9FXL6 | 5-80 | None |
| A0A672HKF6 | 2-80 | None |
| A0A452IG13 | 17-93 | None |
| A0A3Q2PNN4 | 2-76 | None |
| A0A5F5XRF4 | 7-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.