DPCstruct | MC5855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D4S5B3 | 88-170 | ALLSGQSRFLNLQPHMASWRVYPLGVNPVSGNEVGSLAPSTFGGLSYRIIDEPSTDLFSIHTESFGKVNIFAPPDPDSSITST |
| A0A841PSN2 | 212-285 | KTLYLPKTAQTWRVYALNVAPVKGNEKAFLKPAKFGGLQYEVLDIPQKDVVTIQTRDFGKVNIYVAASTGAVIK |
| A0A6D1GKJ9 | 108-177 | None |
| A0A6I6Q0Z2 | 147-229 | None |
| W7BU60 | 132-216 | None |
| A0A843GRV7 | 28-94 | None |
| A0A1H0XNK4 | 282-365 | None |
| A0A844BYS5 | 1-91 | None |
| A0A554A301 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.