DPCstruct | MC58548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 396 |
|---|---|
| Mean domain length (aa) | 137 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 98.99 |
| Assigned Pfam label(s) | CL0123- CL0229- PF20231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KL03 | 7-116 | IPNDYCDFCLGDANLNKKSKAPEEMVSCADCGRSGHPTCLQFTDNMKISVRKYPWQCIECKSCGLCGTSENDEQLLFCDDCDRGYHM… |
| A0A672H4I4 | 13-143 | RSVTDGFITHSLVFRGADDENADSVSDVDKCYICLSPFEQQTVASLDSCQHVFCLHCILLWSQVCPQLHHLSIKVSPVVCEECGRSD… |
| F4Q5I3 | 912-1089 | None |
| A0A2G8LJ72 | 1-110 | None |
| A0A7N2LCM2 | 146-265 | None |
| A0A067BPX9 | 93-246 | None |
| A0A0Q3PI62 | 777-912 | None |
| A0A1U8P997 | 74-192 | None |
| A0A0N5CS09 | 2-127 | None |
| A0A0C2J6W6 | 82-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.