DPCstruct | MC58545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 277 ± 59 aa |
| Standard deviation of domain lengths | 58.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 81.35 |
| Assigned Pfam label(s) | CL0644- CL0124- CL0602- CL0016- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4SFK2 | 180-394 | SCIFYEYKGEFCKDIITSLYVYGNQSTLDYGEKETNTFGGYFNLFEISERCKPVIRDLYCRYHFPPCDETLGEPKDRGLCQRSCLYL… |
| A0A671L5Q7 | 7-284 | EGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGTSNHLSDRCSQFAIPSLCHFAFPTCDRSSGMDKPRDLCKDECE… |
| A0A6P4Z756 | 526-780 | None |
| A0A1X7U1V3 | 22-348 | None |
| A0A2P8Z9A9 | 2-280 | None |
| A0A553P113 | 1-261 | None |
| A0A2B4S9F6 | 41-304 | None |
| A0A7R9KMF6 | 4-332 | None |
| A0A6A4V9L4 | 229-468 | None |
| A0A6I9YP43 | 10-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.