DPCstruct | MC58543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6A5Y1 | 1-77 | MLTVSPGDVLLPVPTAVEKAIGYRPHPTTCTRWTRHGVRGVKLETVVVGGRPRTTEAAVIAFVEAQTANADAPQSDI |
| A0A2Z3HCG1 | 1-54 | MTMSEAGAFIKRDALTLRRWVSKGIRGIKLEAVKVGKSLVTSREAVTRFIAATN |
| A0A5B9MNF5 | 1-76 | None |
| A0A0S8EHT4 | 29-96 | None |
| A0A518HU55 | 1-68 | None |
| A0A2D7EXD7 | 124-193 | None |
| A0A7Y3K110 | 41-122 | None |
| A0A7V2CLH5 | 83-150 | None |
| A0A518H6A5 | 19-83 | None |
| A0A5C5VY39 | 8-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.