DPCstruct | MC5854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 226 ± 32 aa |
| Standard deviation of domain lengths | 31.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5BWV0 | 177-374 | KLHGKTYMDGGIIDNVPLDCLVKREYKDILLIRIFGIGRYKPVKIPDGTTVTTIEPRVDLGNIIDFDSEKSKRNMVIGYFDGLRAVY… |
| A0A512F4S0 | 1-227 | MINGKQYIDGGYSNNLPINLAADHGAKEIYAVSIMDGVPENWDRPEDAVVNFIRTPWQFGPLLDFFPDLSATYVRLGEIRTRQVLGE… |
| A0A660T8P2 | 508-732 | None |
| A0A430AYH3 | 312-576 | None |
| A0A645HP61 | 2-161 | None |
| V5WMA1 | 127-369 | None |
| R3U9T9 | 30-291 | None |
| V5XTR2 | 1-256 | None |
| A0A3G5F7I0 | 299-549 | None |
| A0A7X7W812 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.