DPCstruct | MC58539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7YRL8 | 34-121 | VRFSYPHLKKPYAGDGDGEAKFGVVGLLPKKGNEAAKKLIDTRIAKLLKENKVKALASDKKFVRDGDESGKEEYEGHWTISARETRKP |
| D9QBJ1 | 4-104 | SNPTHVVTGEVRLFYANIFEANSIQGSKPKYSVSLIIPKGDTEMLAKIERAIDATIEVGIGKFGGNRPNKAALKLPLRDDEAYAGAM… |
| A0A6B0E4D0 | 10-92 | None |
| A0A417KJR1 | 378-492 | None |
| U2ULD1 | 2-125 | None |
| A0A0E1XFP3 | 15-125 | None |
| A0A7C1MNH3 | 5-117 | None |
| A0A5C7QDC8 | 34-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.