DPCstruct | MC58530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 285 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 99.63 |
| Assigned Pfam label(s) | PF00067- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090X644 | 11-149 | VTALLACSSNSKTYNIEDYGAKGDSLTINTKPIQKAIDNCSKNGGGIVLIKEGVFISGTIILKDNVTLTVEKNAKLVGSSNPQDYQS… |
| A0A1N7LGR2 | 42-184 | QIVKPTFPDRDFLVTDYGAKPDGKTDATQAFKEAIEAAHDAGGGRVVVPAGTYTTGAIHLKSNVNLHITKDATIKFSQDPKKYLPLV… |
| A0A1L9PC85 | 1-158 | None |
| A0A7K0KE11 | 51-184 | None |
| A0A2V6RZC0 | 2-117 | None |
| A0A820T8M5 | 2-126 | None |
| A0A5N6P3D7 | 13-164 | None |
| A0A803Q4W1 | 2-120 | None |
| Q44496 | 839-956 | None |
| A0A2G3CYJ1 | 11-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.