DPCstruct | MC5853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0KR99 | 116-196 | VRCPAAHGDDPTPCDGPPVVTVLDAQNAGADGCAHHGARLLASLDGGRVYALPDAPAGTAIRVFKAAQDIRPFPWIDGPRT |
| A0A2N8PCW5 | 13-96 | PTLPAAARRRCPAAAAADPTPCDGPPDTATLIDRHGRETAGCVQHCARRLPGLDGARVHPFVPTARALDIYFRASELPPFAWEI |
| A0A1I1TZU7 | 93-175 | None |
| A0A117MN93 | 51-127 | None |
| V9Z544 | 1-68 | None |
| A0A1G9JJW9 | 320-404 | None |
| A0A7G7MKX2 | 1-74 | None |
| A0A4Y3VX41 | 75-161 | None |
| A0A2S6IH25 | 20-95 | None |
| A0A5J4LCV8 | 4-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.