DPCstruct | MC58529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090X2L9 | 11-93 | GDFSSQFWIDEWGYPNSGVYVCDCPSAGHDMIMLDYTKCGKDGEPEVLHIDQENNYKKTFLAVNFEAFIRGLVSEGNYESEEQ |
| A0A223AQD0 | 95-159 | EFWLKEWGYPALGPVIADTISGGHDMVFLDYSECGPEGEPMVVLVDQEDDYSQEILANNFEEFIY |
| A0A518CWX9 | 88-150 | None |
| A0A101PR92 | 9-85 | None |
| A0A1B9AS20 | 83-156 | None |
| A0A534WKA2 | 2-60 | None |
| A0A1Q6KVK0 | 450-532 | None |
| A0A250FZ04 | 77-143 | None |
| A0A553KKQ7 | 15-81 | None |
| A0A6L4A4L5 | 97-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.