DPCstruct | MC58526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 171 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K2Z7V0 | 38-199 | KDGTSWHHGGHYPAYGMGAFKNLPKVFRTLSGTQFKISTAGHQNFKNAMLTTRLYSNKFDYGFANAGRHPLENNSIEPLKSQFLDML… |
| A0A090X0I9 | 1-168 | MVLGFITGGNRFDNYGWVGAWKGATNWVWWMSHTPFSVSKETKERMNYMADVHFEVMNKDGYVGPQDAMHKIPSDGFFNLTRAGSPD… |
| A0A090X1W7 | 1-203 | None |
| A0A3N6GI25 | 488-657 | None |
| A0A379GEG2 | 266-439 | None |
| A0A419S7E4 | 406-562 | None |
| A0A347UUF2 | 471-631 | None |
| A0A894KF59 | 88-257 | None |
| W4PKL8 | 459-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.