DPCstruct | MC58523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090WX95 | 17-97 | GFVAVFAGATNTPIACTIMGGIELFGIESGVFIALACSTAYLFSGGHSGVYASQIIGSPKHKLFKGEKGLSLSEINKKRTK |
| A0A2T5GW29 | 21-115 | FIGAVLGHALAGPIGVPVDLLAALGFVAVFAGAANTPLACTIMGVELFGAETAVPVAVACFVAYACSGHNGIYLSQRVAVPKRAGST… |
| A0A564VH29 | 120-219 | None |
| A0A0L6JWB1 | 41-134 | None |
| R7A2D1 | 77-164 | None |
| A0A645HB99 | 53-157 | None |
| A0A447TDY7 | 1-91 | None |
| A0A7C3G3E4 | 22-117 | None |
| A0A806PZB4 | 105-199 | None |
| A0A1I1CTT6 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.